o.innerHTML = "Page must be an integer number. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ watching = false; "context" : "envParam:entity", resetMenu(); var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); { }, "context" : "", { }, } "action" : "rerender" } { }, "event" : "ProductAnswerComment", //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); { "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "kudosLinksDisabled" : "false", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ lithadmin: [] "truncateBodyRetainsHtml" : "false", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "linkDisabled" : "false" "action" : "rerender" "actions" : [ "event" : "AcceptSolutionAction", o.innerHTML = "Page number must be 1 or greater. { }, var do_scroll = sessionStorage.is_scroll; LITHIUM.Dialog.options['1277960987'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] } "action" : "rerender" "context" : "", o.innerHTML = "Page number can\'t exceed 2. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); ;(function($){ "event" : "removeMessageUserEmailSubscription", "context" : "envParam:quiltName,message", "; "event" : "ProductAnswerComment", { // Register the click event handler ] } "componentId" : "forums.widget.message-view", { LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ $('.community-menu').removeClass('active') var count = 0; ] "context" : "", { { } } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "event" : "ProductMessageEdit", } "action" : "rerender" "action" : "rerender" }, }); { // --> { ] "kudosable" : "true", "action" : "rerender" "actions" : [ }else{ { { { // Set start to true only if the first key in the sequence is pressed { "includeRepliesModerationState" : "false", "event" : "QuickReply", "event" : "MessagesWidgetEditAnswerForm", "}); "defaultAriaLabel" : "", }, LITHIUM.AjaxSupport.useTickets = false; "context" : "envParam:quiltName", }, ] $(this).toggleClass("view-btn-open view-btn-close"); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "event" : "approveMessage", if ( watching ) { }, "context" : "envParam:quiltName,message", { "disableKudosForAnonUser" : "false", } LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); Type NAT: Comment votre système PS4™ est connecté à Internet Vous pouvez utiliser ces informations pour vous faire une idée du degré de difficulté de la connexion à d'autres systèmes PS4™, notamment lorsque vous utilisez les fonctions de communication des jeux. } "context" : "envParam:selectedMessage", { "message" : "2115946", }, "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ } LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "event" : "RevokeSolutionAction", { function doChecks(pagerId, val) { { } { } var element = $(this).parent('li'); $(this).next().toggle(); { "componentId" : "forums.widget.message-view", { Type 2 : Le système est connecté à Internet avec un routeur "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] "context" : "envParam:quiltName", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ } "action" : "rerender" } LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_2ea9ef6e5fd725', 'enableAutoComplete', '#ajaxfeedback_2ea9ef6e5fd725_0', 'LITHIUM:ajaxError', {}, 'PrRaTTypKI8C2J5CNIiDxzSERZ4KRe2RKnElsms1aHs. LITHIUM.AjaxSupport.ComponentEvents.set({ ] return false; "context" : "", "truncateBody" : "true", { "entity" : "2114755", "actions" : [ // Oops. } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { Zeigt, welche Beiträge Ihr cool findet – klickt auf „Gefällt mir“! LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7Fa1suO98NQR9cI5gtY2RG2i8vBHeKYMFWcRl1IrLZE. { { "event" : "MessagesWidgetEditAction", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "actions" : [ ] ', 'ajax'); ] "quiltName" : "ForumMessage", }, "event" : "ProductAnswerComment", "context" : "envParam:feedbackData", { So, you’ll have the best gaming experience if you’re on an open NAT or at least a moderate NAT. "showCountOnly" : "false", ] } "actions" : [ "eventActions" : [ $(this).toggleClass("view-btn-open view-btn-close"); ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'R70WWMPHJNtY1vteNiObgWyKRGEqG5mBRyozDKJQLWU. { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); }, "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" o.innerHTML = "Page number must be 1 or greater. "context" : "envParam:quiltName", sessionStorage.setItem("is_scroll", option); { "useSimpleView" : "false", { "event" : "removeThreadUserEmailSubscription", "actions" : [ } { { { var cookieDomain = 'forum.vodafone.de'; o.innerHTML = ""; { { ] "action" : "pulsate" ', 'ajax'); ] }, } { } ;(function($) { } { LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "action" : "rerender" count = 0; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "showCountOnly" : "false", } "displaySubject" : "true", { }, "action" : "rerender" { "action" : "rerender" "context" : "", "actions" : [ } function setWarning(pagerId) { } LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "kudosable" : "true", { "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "event" : "MessagesWidgetCommentForm", } { "actions" : [ "action" : "rerender" { { "actions" : [ Bist du sicher, dass du fortfahren möchtest? { "linkDisabled" : "false" } "actions" : [ }, "actions" : [ "disableKudosForAnonUser" : "false", '; "context" : "envParam:feedbackData", }, "action" : "pulsate" "showCountOnly" : "false", } { Was bedeutet das und wie kann ich den NAT-Typ ändern?Antwort: Die Abkürzung NAT steht für Network Address Translation. { }, lithstudio: [], $(document).ready(function(){ "action" : "rerender" "context" : "", "action" : "pulsate" "useCountToKudo" : "false", "event" : "RevokeSolutionAction", }, { "dialogContentCssClass" : "lia-panel-dialog-content", LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'iHX536d38_MxppFekPvmjUaWmpEeaJJAXtuBpLl5vi0. }, window.location.replace('/t5/user/userloginpage'); "disableLinks" : "false", { War... Aktivierung ein Internationaler Fritz Box 6591 (20... Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_2ea9ef6e5fd725_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "action" : "rerender" "action" : "rerender" { { "action" : "rerender" { "event" : "addThreadUserEmailSubscription", "parameters" : { { '; "context" : "", $('section.header-announcement').slideUp(); Allgemein ] })(LITHIUM.jQuery); // Pull in global jQuery reference // console.log('watching: ' + key); { "event" : "MessagesWidgetMessageEdit", "selector" : "#kudosButtonV2_1", { "useCountToKudo" : "false", // Reset the conditions so that someone can do it all again. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"CgXwSb4Rx-b8Gv-cNgpGmjd6J4lBlAtWkP7mES668yQ. return false; "defaultAriaLabel" : "", $(this).toggleClass("view-btn-open view-btn-close"); "disableLinks" : "false", { "actions" : [ { { } { Private Daten erfragen wir bei Bedarf. // Register the click event handler "context" : "", element.siblings('li').find('li').removeClass('active'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"});